PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Itr_sc002231.1_g00002.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Convolvulaceae; Ipomoeeae; Ipomoea
Family NAC
Protein Properties Length: 572aa    MW: 64562.1 Da    PI: 4.1532
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Itr_sc002231.1_g00002.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM169.21.3e-52231492128
                      NAM   2 ppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp..kkvkaeekewyfFskrdkkyatgkrknratksgyWka 85 
                              ppGfrFhPtdeelv +yLk+k+ +kkl l ++i e+d+yk++P+dLp  +k+k+++++w+fFs+rd+ky++g r+nratk+gyWka
  Itr_sc002231.1_g00002.1  23 PPGFRFHPTDEELVLYYLKRKICHKKLLL-DAICETDVYKWDPEDLPelSKLKTGDRQWFFFSPRDRKYPNGARSNRATKHGYWKA 107
                              9*************************988.89**************95449999******************************** PP

                      NAM  86 tgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                              tgkd+++++ ++++vg+kktLvfykgrap+g++tdWvmhey+l
  Itr_sc002231.1_g00002.1 108 TGKDRSITC-NSRAVGVKKTLVFYKGRAPTGVRTDWVMHEYTL 149
                              *********.999****************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.44E-6016172IPR003441NAC domain
PROSITE profilePS5100555.73222172IPR003441NAC domain
PfamPF023658.2E-2823149IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 572 aa     Download sequence    Send to blast
MVMEVKITSN SSPSASLSDQ RFPPGFRFHP TDEELVLYYL KRKICHKKLL LDAICETDVY  60
KWDPEDLPEL SKLKTGDRQW FFFSPRDRKY PNGARSNRAT KHGYWKATGK DRSITCNSRA  120
VGVKKTLVFY KGRAPTGVRT DWVMHEYTLD EEEFRRCDCA RDYYALYKVF KKSGAGPKNG  180
EQYGAPFKEE EWDDDEYLDP NCSVDQKKST NPVNDIQPTE NPKPNVPFQY PKDDLEGFLN  240
HIGNEPPPLM QPLSIDYSYD MEHLIGEEDS ESTLLDQSSR ELNVIEQTAL QQYYMQASFE  300
VTESGTSQPL LHEASEVTSS AVCNEQTQAV EEDFLEDFLE MDDLLSTEPD IHKFNMPVEK  360
SDTQLLNDFD GLSEFDLYQD AAMFFHDVGT SEGGQAAESY VNNVLNGTVN QASTYFSDYP  420
EIVNGQQLYF NESNEVSDQL WMHDQSSDIF IPDDINQGGI PSDGWHVTMS SSDGKNSFAQ  480
VEMGEFEPSV GYDNNFMNHP AGANPIQIAR QDDATNSSLS SSLWALVESI PTTPASAAES  540
ALVQLQGVQA NLGEESFVFL YLECCVLSYG CS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A1e-501814911140Stress-induced transcription factor NAC1
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009613291.10.0PREDICTED: uncharacterized protein LOC104106448 isoform X1
RefseqXP_009775198.10.0PREDICTED: uncharacterized protein LOC104225129 isoform X1
TrEMBLQ8LRL80.0Q8LRL8_PETHY; Nam-like protein 7
STRINGSolyc04g072220.2.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA32122451
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G34190.11e-108NAC domain containing protein 17